KLK6 antibody (70R-2466)

Rabbit polyclonal KLK6 antibody raised against the N terminal of KLK6

Synonyms Polyclonal KLK6 antibody, Anti-KLK6 antibody, PRSS18 antibody, hK6 antibody, KLK6, Kallikrein-Related Peptidase 6 antibody, Bssp antibody, KLK-6 antibody, KLK 6, KLK 6 antibody, PRSS9 antibody, MGC9355 antibody, KLK-6, Klk7 antibody, SP59 antibody, ZYME antibody, NEUROSIN antibody
Specificity KLK6 antibody was raised against the N terminal of KLK6
Cross Reactivity Human
Applications WB
Immunogen KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ
Assay Information KLK6 Blocking Peptide, catalog no. 33R-4416, is also available for use as a blocking control in assays to test for specificity of this KLK6 antibody


Western blot analysis using KLK6 antibody (70R-2466)

Recommended KLK6 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLK6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene that encodes KLK6 protein is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. KLK6 is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using KLK6 antibody (70R-2466) | Recommended KLK6 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using KLK6 antibody (70R-2466) | Lung
  • Western blot analysis using KLK6 antibody (70R-2466) | Jurkat Whole Cell lysates stained with SUZ12 antibody at 1.0ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors