KRR1 antibody (70R-4702)

Rabbit polyclonal KRR1 antibody raised against the C terminal of KRR1

Synonyms Polyclonal KRR1 antibody, Anti-KRR1 antibody, Krr1 Small Subunit antibody, RIP-1 antibody, KRR-1 antibody, KRR-1, HRB2 antibody, KRR 1 antibody, KRR 1, KRR1, Ssu Processome Component Homolog antibody
Specificity KRR1 antibody was raised against the C terminal of KRR1
Cross Reactivity Human
Applications WB
Immunogen KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET
Assay Information KRR1 Blocking Peptide, catalog no. 33R-4253, is also available for use as a blocking control in assays to test for specificity of this KRR1 antibody


Western Blot analysis using KRR1 antibody (70R-4702)

KRR1 antibody (70R-4702) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRR1 belongs to the KRR1 family. It contains 1 KH domain. KRR1 is required for 40S ribosome biogenesis. It is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KRR1 antibody (70R-4702) | KRR1 antibody (70R-4702) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors