LAIR2 antibody (70R-5297)

Rabbit polyclonal LAIR2 antibody raised against the N terminal of LAIR2

Synonyms Polyclonal LAIR2 antibody, Anti-LAIR2 antibody, Leukocyte-Associated Immunoglobulin-Like Receptor 2 antibody, LAIR-2 antibody, LAIR 2, MGC71634 antibody, LAIR 2 antibody, LAIR2, CD306 antibody, LAIR-2
Specificity LAIR2 antibody was raised against the N terminal of LAIR2
Cross Reactivity Human
Applications WB
Immunogen LAIR2 antibody was raised using the N terminal of LAIR2 corresponding to a region with amino acids SPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRG
Assay Information LAIR2 Blocking Peptide, catalog no. 33R-8677, is also available for use as a blocking control in assays to test for specificity of this LAIR2 antibody


Western Blot analysis using LAIR2 antibody (70R-5297)

LAIR2 antibody (70R-5297) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LAIR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LAIR2 is a member of the immunoglobulin superfamily. It was identified by its similarity to LAIR1, an inhibitory receptor present on mononuclear leukocytes. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily, including LAIR1. The function of this protein is unknown, although it is thought to be secreted and may help modulate mucosal tolerance. Two transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LAIR2 antibody (70R-5297) | LAIR2 antibody (70R-5297) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors