Lamin B1 antibody (70R-2064)

Rabbit polyclonal Lamin B1 antibody raised against the middle region of LMNB1

Synonyms Polyclonal Lamin B1 antibody, Anti-Lamin B1 antibody, LMN2 antibody, LMN antibody, LMNB1 antibody, LMNB antibody, ADLD antibody, MGC111419 antibody
Specificity Lamin B1 antibody was raised against the middle region of LMNB1
Cross Reactivity Human
Applications WB
Immunogen Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
Assay Information Lamin B1 Blocking Peptide, catalog no. 33R-2393, is also available for use as a blocking control in assays to test for specificity of this Lamin B1 antibody

Images

Western Blot analysis using Lamin B1 antibody (70R-2064)

Lamin B1 antibody (70R-2064) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LMNB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LAMNB1 encodes for one of the two B type proteins of the nuclear lamina, B1. The Vertebrate lamins consist of two types, A and B. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Lamin B1 antibody (70R-2064) | Lamin B1 antibody (70R-2064) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors