LARP4 antibody (70R-4972)

Rabbit polyclonal LARP4 antibody raised against the middle region of LARP4

Synonyms Polyclonal LARP4 antibody, Anti-LARP4 antibody, LARP-4 antibody, DKFZp686E039 antibody, LARP-4, MGC74631 antibody, LARP 4 antibody, LARP 4, PP13296 antibody, LARP4, La Ribonucleoprotein Domain Family Member 4 antibody
Specificity LARP4 antibody was raised against the middle region of LARP4
Cross Reactivity Human
Applications WB
Immunogen LARP4 antibody was raised using the middle region of LARP4 corresponding to a region with amino acids VSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQ
Assay Information LARP4 Blocking Peptide, catalog no. 33R-9818, is also available for use as a blocking control in assays to test for specificity of this LARP4 antibody


Western Blot analysis using LARP4 antibody (70R-4972)

LARP4 antibody (70R-4972) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LARP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LARP4 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LARP4 antibody (70R-4972) | LARP4 antibody (70R-4972) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors