LARP6 antibody (70R-4880)

Rabbit polyclonal LARP6 antibody raised against the middle region of LARP6

Synonyms Polyclonal LARP6 antibody, Anti-LARP6 antibody, LARP 6, ACHN antibody, LARP 6 antibody, LARP-6 antibody, LARP-6, LARP6, La Ribonucleoprotein Domain Family Member 6 antibody, FLJ11196 antibody
Specificity LARP6 antibody was raised against the middle region of LARP6
Cross Reactivity Human
Applications WB
Immunogen LARP6 antibody was raised using the middle region of LARP6 corresponding to a region with amino acids MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC
Assay Information LARP6 Blocking Peptide, catalog no. 33R-6082, is also available for use as a blocking control in assays to test for specificity of this LARP6 antibody


Western Blot analysis using LARP6 antibody (70R-4880)

LARP6 antibody (70R-4880) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LARP6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LARP6 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LARP6 antibody (70R-4880) | LARP6 antibody (70R-4880) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors