LARP7 antibody (70R-4953)

Rabbit polyclonal LARP7 antibody raised against the C terminal of LARP7

Synonyms Polyclonal LARP7 antibody, Anti-LARP7 antibody, LARP 7, LARP 7 antibody, LARP-7 antibody, LARP7, HDCMA18P antibody, DKFZP564K112 antibody, MGC104360 antibody, LARP-7, La Ribonucleoprotein Domain Family Member 7 antibody
Specificity LARP7 antibody was raised against the C terminal of LARP7
Cross Reactivity Human
Applications WB
Immunogen LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD
Assay Information LARP7 Blocking Peptide, catalog no. 33R-9993, is also available for use as a blocking control in assays to test for specificity of this LARP7 antibody


Western Blot analysis using LARP7 antibody (70R-4953)

LARP7 antibody (70R-4953) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LARP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LARP7 is involved in RNA binding and nucleotide binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LARP7 antibody (70R-4953) | LARP7 antibody (70R-4953) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors