LASP1 antibody (70R-2366)

Rabbit polyclonal LASP1 antibody raised against the C terminal of LASP1

Synonyms Polyclonal LASP1 antibody, Anti-LASP1 antibody, LASP-1, LASP 1, LASP1, MLN50 antibody, Lim And Sh3 Protein 1 antibody, LASP 1 antibody, LASP-1 antibody, Lasp-1 antibody
Specificity LASP1 antibody was raised against the C terminal of LASP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LASP1 antibody was raised using the C terminal of LASP1 corresponding to a region with amino acids SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN
Assay Information LASP1 Blocking Peptide, catalog no. 33R-8949, is also available for use as a blocking control in assays to test for specificity of this LASP1 antibody


Western Blot analysis using LASP1 antibody (70R-2366)

LASP1 antibody (70R-2366) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LASP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LASP1 antibody (70R-2366) | LASP1 antibody (70R-2366) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors