LDHC antibody (70R-2542)

Rabbit polyclonal LDHC antibody raised against the middle region of LDHC

Synonyms Polyclonal LDHC antibody, Anti-LDHC antibody, MGC111073 antibody, Lactate Dehydrogenase C antibody, LDHX antibody, LDH3 antibody
Specificity LDHC antibody was raised against the middle region of LDHC
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV
Assay Information LDHC Blocking Peptide, catalog no. 33R-4202, is also available for use as a blocking control in assays to test for specificity of this LDHC antibody

Images

Western Blot analysis using LDHC antibody (70R-2542)

LDHC antibody (70R-2542) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LDHC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LDHC antibody (70R-2542) | LDHC antibody (70R-2542) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors