LDHD antibody (70R-3502)

Rabbit polyclonal LDHD antibody raised against the middle region of LDHD

Synonyms Polyclonal LDHD antibody, Anti-LDHD antibody, MGC57726 antibody, Lactate Dehydrogenase D antibody
Specificity LDHD antibody was raised against the middle region of LDHD
Cross Reactivity Human
Applications WB
Immunogen LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV
Assay Information LDHD Blocking Peptide, catalog no. 33R-5196, is also available for use as a blocking control in assays to test for specificity of this LDHD antibody

Images

Western Blot analysis using LDHD antibody (70R-3502)

LDHD antibody (70R-3502) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LDHD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LDHD antibody (70R-3502) | LDHD antibody (70R-3502) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors