Leiomodin 1 antibody (70R-3808)

Rabbit polyclonal Leiomodin 1 antibody

Synonyms Polyclonal Leiomodin 1 antibody, Anti-Leiomodin 1 antibody, Leiomodin -1 antibody, SM-LMOD antibody, Leiomodin -1, Leiomodin 1 antibody, 64kD antibody, , LMOD1 antibody, D1 antibody, 1D antibody, Leiomodin 1, Leiomodin 1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Leiomodin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ
Assay Information Leiomodin 1 Blocking Peptide, catalog no. 33R-8783, is also available for use as a blocking control in assays to test for specificity of this Leiomodin 1 antibody

Images

Western Blot analysis using Leiomodin 1 antibody (70R-3808)

Leiomodin 1 antibody (70R-3808) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LMOD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The leiomodin 1 protein (LMOD1) has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Leiomodin 1 antibody (70R-3808) | Leiomodin 1 antibody (70R-3808) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors