LETM1 antibody (70R-1752)

Rabbit polyclonal LETM1 antibody raised against the middle region of LETM1

Synonyms Polyclonal LETM1 antibody, Anti-LETM1 antibody, LETM1, Leucine Zipper-Ef-Hand Containing Transmembrane Protein 1 antibody, LETM 1, LETM 1 antibody, LETM-1, LETM-1 antibody
Specificity LETM1 antibody was raised against the middle region of LETM1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN
Assay Information LETM1 Blocking Peptide, catalog no. 33R-5689, is also available for use as a blocking control in assays to test for specificity of this LETM1 antibody


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LETM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The LETM1 is a factor of the mitochondrial K+ homeostasis with a potential role in the Wolf-Hirschhorn syndrome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors