LIAS antibody (70R-2255)

Rabbit polyclonal LIAS antibody raised against the C terminal of LIAS

Synonyms Polyclonal LIAS antibody, Anti-LIAS antibody, MGC23245 antibody, LAS antibody, LIP1 antibody, Lipoic Acid Synthetase antibody, HUSSY-01 antibody
Specificity LIAS antibody was raised against the C terminal of LIAS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LIAS antibody was raised using the C terminal of LIAS corresponding to a region with amino acids EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK
Assay Information LIAS Blocking Peptide, catalog no. 33R-2822, is also available for use as a blocking control in assays to test for specificity of this LIAS antibody


Western Blot analysis using LIAS antibody (70R-2255)

LIAS antibody (70R-2255) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIAS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LIAS antibody (70R-2255) | LIAS antibody (70R-2255) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors