LIG1 antibody (70R-5621)

Rabbit polyclonal LIG1 antibody raised against the middle region of LIG1

Synonyms Polyclonal LIG1 antibody, Anti-LIG1 antibody, LIG-1, Ligase I Dna Atp-Dependent antibody, MGC117397 antibody, LIG 1, LIG-1 antibody, MGC130025 antibody, LIG1, LIG 1 antibody
Specificity LIG1 antibody was raised against the middle region of LIG1
Cross Reactivity Human,Mouse
Applications WB
Immunogen LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR
Assay Information LIG1 Blocking Peptide, catalog no. 33R-1328, is also available for use as a blocking control in assays to test for specificity of this LIG1 antibody


Western Blot analysis using LIG1 antibody (70R-5621)

LIG1 antibody (70R-5621) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 102 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LIG1 encodes DNA ligase I, with functions in DNA replication and the base excision repair process. Mutations in LIG1 that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LIG1 antibody (70R-5621) | LIG1 antibody (70R-5621) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors