LIN7C antibody (70R-2196)

Rabbit polyclonal LIN7C antibody

Synonyms Polyclonal LIN7C antibody, Anti-LIN7C antibody, Lin-7 Homolog C antibody, MALS-3 antibody, LINC-7, LIN-7C antibody, LIN7C, LINC 7 antibody, FLJ11215 antibody, LIN-7-C antibody, LINC-7 antibody, VELI3 antibody, LINC 7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
Assay Information LIN7C Blocking Peptide, catalog no. 33R-5599, is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody


Immunohistochemical staining using LIN7C antibody (70R-2196)

LIN7C antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIN7C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using LIN7C antibody (70R-2196) | LIN7C antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using LIN7C antibody (70R-2196) | LIN7C antibody (70R-2196) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors