LIN7C antibody (70R-2578)

Rabbit polyclonal LIN7C antibody

Synonyms Polyclonal LIN7C antibody, Anti-LIN7C antibody, LINC-7, FLJ11215 antibody, VELI3 antibody, MALS-3 antibody, LINC 7 antibody, LIN-7C antibody, LINC-7 antibody, LIN7C, Lin-7 Homolog C antibody, LINC 7, LIN-7-C antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV
Assay Information LIN7C Blocking Peptide, catalog no. 33R-6031, is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody


Immunohistochemical staining using LIN7C antibody (70R-2578)

LIN7C antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIN7C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using LIN7C antibody (70R-2578) | LIN7C antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using LIN7C antibody (70R-2578) | LIN7C antibody (70R-2578) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using LIN7C antibody (70R-2578) | LIN7C antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors