LIX1 antibody (70R-3596)

Rabbit polyclonal LIX1 antibody

Synonyms Polyclonal LIX1 antibody, Anti-LIX1 antibody, FLJ25534 antibody, LIX1, Lix1 Homolog antibody, LIX-1 antibody, LIX-1, LIX 1, LIX 1 antibody, C5orf11 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LIX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES
Assay Information LIX1 Blocking Peptide, catalog no. 33R-9181, is also available for use as a blocking control in assays to test for specificity of this LIX1 antibody


Western Blot analysis using LIX1 antibody (70R-3596)

LIX1 antibody (70R-3596) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LIX1 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LIX1 antibody (70R-3596) | LIX1 antibody (70R-3596) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors