LIX1L antibody (70R-3539)

Rabbit polyclonal LIX1L antibody

Synonyms Polyclonal LIX1L antibody, Anti-LIX1L antibody, Lix1 Homolog antibody, LIX 1, LIX1, MGC46719 antibody, LIX 1 antibody, LIX-1 antibody, LIX-1, DKFZp762F237 antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen LIX1L antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN
Assay Information LIX1L Blocking Peptide, catalog no. 33R-1225, is also available for use as a blocking control in assays to test for specificity of this LIX1L antibody


Western Blot analysis using LIX1L antibody (70R-3539)

LIX1L antibody (70R-3539) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIX1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LIX1L may function as a modulator of fat signaling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LIX1L antibody (70R-3539) | LIX1L antibody (70R-3539) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors