LMAN1 antibody (70R-1877)

Rabbit polyclonal LMAN1 antibody raised against the middle region of LMAN1

Synonyms Polyclonal LMAN1 antibody, Anti-LMAN1 antibody, LMAN 1, MR60 antibody, F5F8D antibody, FMFD1 antibody, LMAN-1 antibody, LMAN1, Lectin Mannose-Binding 1 antibody, gp58 antibody, LMAN 1 antibody, LMAN-1, ERGIC-53 antibody, ERGIC53 antibody, MCFD1 antibody
Specificity LMAN1 antibody was raised against the middle region of LMAN1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen LMAN1 antibody was raised using the middle region of LMAN1 corresponding to a region with amino acids DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR
Assay Information LMAN1 Blocking Peptide, catalog no. 33R-2022, is also available for use as a blocking control in assays to test for specificity of this LMAN1 antibody


Western Blot analysis using LMAN1 antibody (70R-1877)

LMAN1 antibody (70R-1877) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LMAN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LMAN1 antibody (70R-1877) | LMAN1 antibody (70R-1877) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors