LOC116349 antibody (70R-4146)

Rabbit polyclonal LOC116349 antibody raised against the N terminal of LOC116349

Synonyms Polyclonal LOC116349 antibody, Anti-LOC116349 antibody, LOC-116349, LOC 116349, LOC 116349 antibody, Hypothetical Protein Bc014011 antibody, LOC-116349 antibody, LOC116349
Specificity LOC116349 antibody was raised against the N terminal of LOC116349
Cross Reactivity Human
Applications WB
Immunogen LOC116349 antibody was raised using the N terminal of LOC116349 corresponding to a region with amino acids PAVFMLASSSALQCGRGVPRFPRTEVGAGHSVNEETKAEKVGNQTSVIPA
Assay Information LOC116349 Blocking Peptide, catalog no. 33R-6987, is also available for use as a blocking control in assays to test for specificity of this LOC116349 antibody


Western Blot analysis using LOC116349 antibody (70R-4146)

LOC116349 antibody (70R-4146) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC116349 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC116349 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LOC116349 antibody (70R-4146) | LOC116349 antibody (70R-4146) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors