LOC400451 antibody (70R-1842)

Rabbit polyclonal LOC400451 antibody raised against the C terminal of LOC400451

Synonyms Polyclonal LOC400451 antibody, Anti-LOC400451 antibody, LOC400451, MGC102891 antibody, LOC 400451 antibody, LOC-400451 antibody, Hypothetical Gene Supported By Ak075564; Bc060873 antibody, LOC 400451, LOC-400451
Specificity LOC400451 antibody was raised against the C terminal of LOC400451
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen LOC400451 antibody was raised using the C terminal of LOC400451 corresponding to a region with amino acids FTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDED
Assay Information LOC400451 Blocking Peptide, catalog no. 33R-3105, is also available for use as a blocking control in assays to test for specificity of this LOC400451 antibody


Immunohistochemical staining using LOC400451 antibody (70R-1842)

LOC400451 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LOC400451 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC400451 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using LOC400451 antibody (70R-1842) | LOC400451 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using LOC400451 antibody (70R-1842) | LOC400451 antibody (70R-1842) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors