LOC554235 antibody (70R-4304)

Rabbit polyclonal LOC554235 antibody raised against the N terminal of LOC554235

Synonyms Polyclonal LOC554235 antibody, Anti-LOC554235 antibody, LOC-554235, LOC 554235, LOC554235, LOC-554235 antibody, Hypothetical Protein Loc554235 antibody, LOC 554235 antibody
Specificity LOC554235 antibody was raised against the N terminal of LOC554235
Cross Reactivity Human,Mouse
Applications WB
Immunogen LOC554235 antibody was raised using the N terminal of LOC554235 corresponding to a region with amino acids VVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA
Assay Information LOC554235 Blocking Peptide, catalog no. 33R-9873, is also available for use as a blocking control in assays to test for specificity of this LOC554235 antibody

Images

Western Blot analysis using LOC554235 antibody (70R-4304)

LOC554235 antibody (70R-4304) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC554235 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC554235 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC554235 antibody (70R-4304) | LOC554235 antibody (70R-4304) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors