LOC63920 antibody (70R-3992)

Rabbit polyclonal LOC63920 antibody raised against the N terminal of LOC63920

Synonyms Polyclonal LOC63920 antibody, Anti-LOC63920 antibody, LOC-63920 antibody, LOC 63920, LOC 63920 antibody, LOC-63920, Chromosome 5 Open Reading Frame 54 antibody, LOC63920
Specificity LOC63920 antibody was raised against the N terminal of LOC63920
Cross Reactivity Human
Applications WB
Immunogen LOC63920 antibody was raised using the N terminal of LOC63920 corresponding to a region with amino acids SVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGV
Assay Information LOC63920 Blocking Peptide, catalog no. 33R-8909, is also available for use as a blocking control in assays to test for specificity of this LOC63920 antibody


Western Blot analysis using LOC63920 antibody (70R-3992)

LOC63920 antibody (70R-3992) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC63920 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC63920 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LOC63920 antibody (70R-3992) | LOC63920 antibody (70R-3992) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors