LOC645015 antibody (70R-2372)

Rabbit polyclonal LOC645015 antibody raised against the middle region of LOC645015

Synonyms Polyclonal LOC645015 antibody, Anti-LOC645015 antibody, LOC-645015 antibody, LOC 645015, LOC 645015 antibody, Similar To Mannosyltransferase antibody, LOC645015, LOC-645015
Specificity LOC645015 antibody was raised against the middle region of LOC645015
Cross Reactivity Human
Applications WB
Immunogen LOC645015 antibody was raised using the middle region of LOC645015 corresponding to a region with amino acids LPSLVCVITGQGPLTEYYSRPIHQKHFQHIQVCNPWLEAEDYPLLLGSVD
Assay Information LOC645015 Blocking Peptide, catalog no. 33R-5290, is also available for use as a blocking control in assays to test for specificity of this LOC645015 antibody

Images

Western Blot analysis using LOC645015 antibody (70R-2372)

LOC645015 antibody (70R-2372) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC645015 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC645015 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC645015 antibody (70R-2372) | LOC645015 antibody (70R-2372) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors