LOC646951 antibody (70R-4387)

Rabbit polyclonal LOC646951 antibody raised against the middle region of LOC646951

Synonyms Polyclonal LOC646951 antibody, Anti-LOC646951 antibody, LOC646951, LOC 646951 antibody, Similar To Hcg1786685 antibody, LOC 646951, LOC-646951 antibody, LOC-646951
Specificity LOC646951 antibody was raised against the middle region of LOC646951
Cross Reactivity Human
Applications WB
Immunogen LOC646951 antibody was raised using the middle region of LOC646951 corresponding to a region with amino acids SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING
Assay Information LOC646951 Blocking Peptide, catalog no. 33R-8712, is also available for use as a blocking control in assays to test for specificity of this LOC646951 antibody

Images

Western Blot analysis using LOC646951 antibody (70R-4387)

LOC646951 antibody (70R-4387) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC646951 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC646951 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC646951 antibody (70R-4387) | LOC646951 antibody (70R-4387) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors