LOC653186 antibody (70R-1184)

Rabbit polyclonal LOC653186 antibody raised against the N terminal of LOC653186

Synonyms Polyclonal LOC653186 antibody, Anti-LOC653186 antibody, LOC653186, Hypothetical Loc653186 antibody, LOC 653186, LOC 653186 antibody, LOC-653186 antibody, LOC-653186
Specificity LOC653186 antibody was raised against the N terminal of LOC653186
Cross Reactivity Human
Applications WB
Immunogen LOC653186 antibody was raised using the N terminal of LOC653186 corresponding to a region with amino acids MKVINAKLDGFYSFPIFLFQFLQATAQEEGIFECADPKLAISAIWTFRDL
Assay Information LOC653186 Blocking Peptide, catalog no. 33R-6172, is also available for use as a blocking control in assays to test for specificity of this LOC653186 antibody

Images

Western Blot analysis using LOC653186 antibody (70R-1184)

LOC653186 antibody (70R-1184) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LOC653186 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC653186 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC653186 antibody (70R-1184) | LOC653186 antibody (70R-1184) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors