LONRF1 antibody (70R-1168)

Rabbit polyclonal LONRF1 antibody raised against the N terminal of LONRF1

Synonyms Polyclonal LONRF1 antibody, Anti-LONRF1 antibody, LONRF-1 antibody, RNF191 antibody, FLJ23749 antibody, Lon Peptidase N-Terminal Domain And Ring Finger 1 antibody, LONRF 1 antibody, LONRF1, LONRF-1, LONRF 1
Specificity LONRF1 antibody was raised against the N terminal of LONRF1
Cross Reactivity Human
Applications IHC, WB
Immunogen LONRF1 antibody was raised using the N terminal of LONRF1 corresponding to a region with amino acids MSSPAVARTSPGGSREMAPAPQGRGRFWEVGGGSGHRLERAAAESERWEL
Assay Information LONRF1 Blocking Peptide, catalog no. 33R-6504, is also available for use as a blocking control in assays to test for specificity of this LONRF1 antibody


Immunohistochemical staining using LONRF1 antibody (70R-1168)

LONRF1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LONRF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LONRF1 is involved in protein binding, zinc ion binding, ATP-dependent peptidase activity and metal ion binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using LONRF1 antibody (70R-1168) | LONRF1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using LONRF1 antibody (70R-1168) | LONRF1 antibody (70R-1168) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors