LONRF3 antibody (70R-2616)

Rabbit polyclonal LONRF3 antibody raised against the middle region of LONRF3

Synonyms Polyclonal LONRF3 antibody, Anti-LONRF3 antibody, LONRF 3 antibody, RNF127 antibody, LONRF-3, LONRF-3 antibody, MGC119465 antibody, Lon Peptidase N-Terminal Domain And Ring Finger 3 antibody, LONRF 3, LONRF3, MGC119463 antibody, FLJ22612 antibody
Specificity LONRF3 antibody was raised against the middle region of LONRF3
Cross Reactivity Human
Applications WB
Immunogen LONRF3 antibody was raised using the middle region of LONRF3 corresponding to a region with amino acids LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG
Assay Information LONRF3 Blocking Peptide, catalog no. 33R-4906, is also available for use as a blocking control in assays to test for specificity of this LONRF3 antibody


Western Blot analysis using LONRF3 antibody (70R-2616)

LONRF3 antibody (70R-2616) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LONRF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LONRF3 antibody (70R-2616) | LONRF3 antibody (70R-2616) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors