LPP antibody (70R-2082)

Rabbit polyclonal LPP antibody raised against the N terminal of LPP

Synonyms Polyclonal LPP antibody, Anti-LPP antibody, Lim Domain Containing Preferred Translocation Partner In Lipoma antibody
Specificity LPP antibody was raised against the N terminal of LPP
Cross Reactivity Human
Applications WB
Immunogen LPP antibody was raised using the N terminal of LPP corresponding to a region with amino acids GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST
Assay Information LPP Blocking Peptide, catalog no. 33R-3379, is also available for use as a blocking control in assays to test for specificity of this LPP antibody

Images

Western Blot analysis using LPP antibody (70R-2082)

LPP antibody (70R-2082) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LPP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LPP antibody (70R-2082) | LPP antibody (70R-2082) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors