LRRC20 antibody (70R-4372)

Rabbit polyclonal LRRC20 antibody raised against the middle region of LRRC20

Synonyms Polyclonal LRRC20 antibody, Anti-LRRC20 antibody, LRRC 20, FLJ10844 antibody, LRRC20, FLJ10751 antibody, LRRC 20 antibody, Leucine Rich Repeat Containing 20 antibody, LRRC-20, LRRC-20 antibody
Specificity LRRC20 antibody was raised against the middle region of LRRC20
Cross Reactivity Human
Applications WB
Immunogen LRRC20 antibody was raised using the middle region of LRRC20 corresponding to a region with amino acids TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALP
Assay Information LRRC20 Blocking Peptide, catalog no. 33R-9314, is also available for use as a blocking control in assays to test for specificity of this LRRC20 antibody


Western Blot analysis using LRRC20 antibody (70R-4372)

LRRC20 antibody (70R-4372) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LRRC20 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LRRC20 antibody (70R-4372) | LRRC20 antibody (70R-4372) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors