LRRC50 antibody (70R-3850)

Rabbit polyclonal LRRC50 antibody raised against the N terminal of LRRC50

Synonyms Polyclonal LRRC50 antibody, Anti-LRRC50 antibody, FLJ25330 antibody, LRRC-50 antibody, DKFZp434A119 antibody, LRRC-50, LRRC50, LRRC 50 antibody, Leucine Rich Repeat Containing 50 antibody, LRRC 50
Specificity LRRC50 antibody was raised against the N terminal of LRRC50
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTL
Assay Information LRRC50 Blocking Peptide, catalog no. 33R-9045, is also available for use as a blocking control in assays to test for specificity of this LRRC50 antibody


Western Blot analysis using LRRC50 antibody (70R-3850)

LRRC50 antibody (70R-3850) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC50 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC50 contains 6 LRR (leucine-rich) repeats. It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LRRC50 antibody (70R-3850) | LRRC50 antibody (70R-3850) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors