LRRC51 antibody (70R-3794)

Rabbit polyclonal LRRC51 antibody raised against the N terminal of LRRC51

Synonyms Polyclonal LRRC51 antibody, Anti-LRRC51 antibody, LRRC-51 antibody, Leucine Rich Repeat Containing 51 antibody, LRRC 51 antibody, LRRC 51, LRRC-51, LRRC51
Specificity LRRC51 antibody was raised against the N terminal of LRRC51
Cross Reactivity Human
Applications WB
Immunogen LRRC51 antibody was raised using the N terminal of LRRC51 corresponding to a region with amino acids MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL
Assay Information LRRC51 Blocking Peptide, catalog no. 33R-6248, is also available for use as a blocking control in assays to test for specificity of this LRRC51 antibody

Images

Western Blot analysis using LRRC51 antibody (70R-3794)

LRRC51 antibody (70R-3794) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC51 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC51 encodes two different proteins. One is a leucine-rich transmembrane protein of unknown function while the other is an O-methyltransferase. Defects in the O-methyltransferase protein can cause nonsyndromic deafness. Several transcript variants encoding different isoforms of each protein have been found for this gene, along with a transcript that is not thought to be protein-coding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC51 antibody (70R-3794) | LRRC51 antibody (70R-3794) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors