LRRC56 antibody (70R-4203)

Rabbit polyclonal LRRC56 antibody raised against the N terminal of LRRC56

Synonyms Polyclonal LRRC56 antibody, Anti-LRRC56 antibody, LRRC 56 antibody, LRRC56, FLJ00101 antibody, DKFZp761L1518 antibody, LRRC-56, LRRC 56, LRRC-56 antibody, Leucine Rich Repeat Containing 56 antibody
Specificity LRRC56 antibody was raised against the N terminal of LRRC56
Cross Reactivity Human,Mouse
Applications WB
Immunogen LRRC56 antibody was raised using the N terminal of LRRC56 corresponding to a region with amino acids LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL
Assay Information LRRC56 Blocking Peptide, catalog no. 33R-4915, is also available for use as a blocking control in assays to test for specificity of this LRRC56 antibody

Images

Western Blot analysis using LRRC56 antibody (70R-4203)

LRRC56 antibody (70R-4203) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC56 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LRRC56 contains 3 LRR (leucine-rich) repeats. The exact function of LRRC56 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRC56 antibody (70R-4203) | LRRC56 antibody (70R-4203) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors