LSM2 antibody (70R-1438)

Rabbit polyclonal LSM2 antibody

Synonyms Polyclonal LSM2 antibody, Anti-LSM2 antibody, Lsm2 Homolog U6 Small Nuclear Rna Associated antibody, LSM2, LSM 2 antibody, LSM-2, LSM 2, LSM-2 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen LSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Assay Information LSM2 Blocking Peptide, catalog no. 33R-9016, is also available for use as a blocking control in assays to test for specificity of this LSM2 antibody


Immunohistochemical staining using LSM2 antibody (70R-1438)

LSM2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LSM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using LSM2 antibody (70R-1438) | LSM2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.
  • Western Blot analysis using LSM2 antibody (70R-1438) | LSM2 antibody (70R-1438) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using LSM2 antibody (70R-1438) | LSM2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors