LYN antibody (70R-3701)

Rabbit polyclonal LYN antibody raised against the N terminal of LYN

Synonyms Polyclonal LYN antibody, Anti-LYN antibody, FLJ26625 antibody, JTK8 antibody, V-Yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog antibody
Specificity LYN antibody was raised against the N terminal of LYN
Cross Reactivity Human
Applications WB
Immunogen LYN antibody was raised using the N terminal of LYN corresponding to a region with amino acids DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF
Assay Information LYN Blocking Peptide, catalog no. 33R-2118, is also available for use as a blocking control in assays to test for specificity of this LYN antibody


Western blot analysis using LYN antibody (70R-3701)

Tissue analyzed: Human Fetal Brain; Antibody Dilution: 1.0ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LYN down regulates expression of stem cell growth factor receptor (KIT).LYN acts as an effector of EpoR (erythropoietin receptor) in controlling KIT expression and may play a central role in erythroid differentiation during the switch between proliferation and maturation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using LYN antibody (70R-3701) | Tissue analyzed: Human Fetal Brain; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using LYN antibody (70R-3701) | Tissue analyzed: Human Fetal Lung; Antibody Dilution: 1.0ug/m
  • Western blot analysis using LYN antibody (70R-3701) | Recommended LYN Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using LYN antibody (70R-3701) | Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/m

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors