LYPD6 antibody (70R-5418)

Rabbit polyclonal LYPD6 antibody raised against the middle region of LYPD6

Synonyms Polyclonal LYPD6 antibody, Anti-LYPD6 antibody, LYPD 6, LYPD 6 antibody, MGC52057 antibody, LYPD-6 antibody, Ly6/Plaur Domain Containing 6 antibody, LYPD-6, LYPD6
Specificity LYPD6 antibody was raised against the middle region of LYPD6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LYPD6 antibody was raised using the middle region of LYPD6 corresponding to a region with amino acids RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS
Assay Information LYPD6 Blocking Peptide, catalog no. 33R-7859, is also available for use as a blocking control in assays to test for specificity of this LYPD6 antibody


Western Blot analysis using LYPD6 antibody (70R-5418)

LYPD6 antibody (70R-5418) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYPD6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LYPD6 antibody (70R-5418) | LYPD6 antibody (70R-5418) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors