LYZL6 antibody (70R-5463)

Rabbit polyclonal LYZL6 antibody raised against the N terminal of LYZL6

Synonyms Polyclonal LYZL6 antibody, Anti-LYZL6 antibody, Lysozyme-Like 6 antibody, LYC1 antibody, LYZL6, LYZL 6 antibody, 1700023H08Rik antibody, PRO1485 antibody, LYZL-6, TKAL754 antibody, LYZL 6, LYZL-6 antibody
Specificity LYZL6 antibody was raised against the N terminal of LYZL6
Cross Reactivity Human
Applications WB
Immunogen LYZL6 antibody was raised using the N terminal of LYZL6 corresponding to a region with amino acids MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL
Assay Information LYZL6 Blocking Peptide, catalog no. 33R-6547, is also available for use as a blocking control in assays to test for specificity of this LYZL6 antibody


Western Blot analysis using LYZL6 antibody (70R-5463)

LYZL6 antibody (70R-5463) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYZL6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LYZL6 antibody (70R-5463) | LYZL6 antibody (70R-5463) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors