MAGEA6 antibody (70R-3558)

Rabbit polyclonal MAGEA6 antibody raised against the middle region of MAGEA6

Synonyms Polyclonal MAGEA6 antibody, Anti-MAGEA6 antibody, MAGEA-6 antibody, Melanoma Antigen Family A 6 antibody, MAGE-3b antibody, MAGE6 antibody, MAGE3B antibody, MGC52297 antibody, MAGEA 6 antibody, MAGEA6, MAGEA 6, MAGEA-6
Specificity MAGEA6 antibody was raised against the middle region of MAGEA6
Cross Reactivity Human
Applications WB
Immunogen MAGEA6 antibody was raised using the middle region of MAGEA6 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSD
Assay Information MAGEA6 Blocking Peptide, catalog no. 33R-1419, is also available for use as a blocking control in assays to test for specificity of this MAGEA6 antibody


Western Blot analysis using MAGEA6 antibody (70R-3558)

MAGEA6 antibody (70R-3558) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAGEA6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAGEA6 gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAGEA6 antibody (70R-3558) | MAGEA6 antibody (70R-3558) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors