MAGEB2 antibody (70R-4319)

Rabbit polyclonal MAGEB2 antibody raised against the N terminal of MAGEB2

Synonyms Polyclonal MAGEB2 antibody, Anti-MAGEB2 antibody, MAGEB 2 antibody, MAGEB-2 antibody, Melanoma Antigen Family B 2 antibody, MAGE-XP-2 antibody, MAGEB-2, MAGEB 2, MAGEB2, MGC26438 antibody, DAM6 antibody
Specificity MAGEB2 antibody was raised against the N terminal of MAGEB2
Cross Reactivity Human
Applications WB
Immunogen MAGEB2 antibody was raised using the N terminal of MAGEB2 corresponding to a region with amino acids MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA
Assay Information MAGEB2 Blocking Peptide, catalog no. 33R-6302, is also available for use as a blocking control in assays to test for specificity of this MAGEB2 antibody


Western Blot analysis using MAGEB2 antibody (70R-4319)

MAGEB2 antibody (70R-4319) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAGEB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAGEB2 antibody (70R-4319) | MAGEB2 antibody (70R-4319) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors