MAP2K3 antibody (70R-2685)

Rabbit polyclonal MAP2K3 antibody raised against the C terminal of MAP2K3

Synonyms Polyclonal MAP2K3 antibody, Anti-MAP2K3 antibody, MKK3 antibody, PRKMK3 antibody, Mitogen-Activated Protein Kinase 3 antibody, MAPKK3 antibody, MAP 2, MAP-2, MAP-2 antibody, MEK3 antibody, MAP 2 antibody, MAP2
Specificity MAP2K3 antibody was raised against the C terminal of MAP2K3
Cross Reactivity Human
Applications WB
Immunogen MAP2K3 antibody was raised using the C terminal of MAP2K3 corresponding to a region with amino acids EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKK
Assay Information MAP2K3 Blocking Peptide, catalog no. 33R-2380, is also available for use as a blocking control in assays to test for specificity of this MAP2K3 antibody


Western Blot analysis using MAP2K3 antibody (70R-2685)

MAP2K3 antibody (70R-2685) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP2K3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAP2K3 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAP2K3 antibody (70R-2685) | MAP2K3 antibody (70R-2685) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors