MAP2K7 antibody (70R-2695)

Rabbit polyclonal MAP2K7 antibody raised against the middle region of MAP2K7

Synonyms Polyclonal MAP2K7 antibody, Anti-MAP2K7 antibody, MAP 2 antibody, Mitogen-Activated Protein Kinase 7 antibody, MAP 2, MAP-2 antibody, MAPKK7 antibody, MAP2, MAP-2, MKK7 antibody, PRKMK7 antibody, Jnkk2 antibody
Specificity MAP2K7 antibody was raised against the middle region of MAP2K7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAP2K7 antibody was raised using the middle region of MAP2K7 corresponding to a region with amino acids ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL
Assay Information MAP2K7 Blocking Peptide, catalog no. 33R-2695, is also available for use as a blocking control in assays to test for specificity of this MAP2K7 antibody

Images

Western Blot analysis using MAP2K7 antibody (70R-2695)

MAP2K7 antibody (70R-2695) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP2K7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAP2K7 is a stress activated, dual specificity kinase that activates the JUN kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAP2K7 antibody (70R-2695) | MAP2K7 antibody (70R-2695) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors