MAT1A antibody (70R-1146)

Rabbit polyclonal MAT1A antibody raised against the C terminal of MAT1A

Synonyms Polyclonal MAT1A antibody, Anti-MAT1A antibody, MAT1A, MATA-1, MATA-1 antibody, MAT antibody, SAMS1 antibody, MATA1 antibody, SAMS antibody, MATA 1, MATA 1 antibody, Methionine Adenosyltransferase I Alpha antibody
Specificity MAT1A antibody was raised against the C terminal of MAT1A
Cross Reactivity Human,Dog
Applications WB
Immunogen MAT1A antibody was raised using the C terminal of MAT1A corresponding to a region with amino acids VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH
Assay Information MAT1A Blocking Peptide, catalog no. 33R-9422, is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody


Western Blot analysis using MAT1A antibody (70R-1146)

MAT1A antibody (70R-1146) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MAT1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAT1A catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. MAT1A is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in its gene are associated with methionine adenosyltransferase deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAT1A antibody (70R-1146) | MAT1A antibody (70R-1146) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors