MAT1A antibody (70R-1172)

Rabbit polyclonal MAT1A antibody raised against the N terminal of MAT1A

Synonyms Polyclonal MAT1A antibody, Anti-MAT1A antibody, MAT1A, MATA1 antibody, MAT antibody, SAMS1 antibody, SAMS antibody, MATA 1, MATA-1, MATA 1 antibody, Methionine Adenosyltransferase I Alpha antibody, MATA-1 antibody
Specificity MAT1A antibody was raised against the N terminal of MAT1A
Cross Reactivity Human,Mouse,Rat,Dog,C.elegans,Drosophila
Applications IHC, WB
Immunogen MAT1A antibody was raised using the N terminal of MAT1A corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE
Assay Information MAT1A Blocking Peptide, catalog no. 33R-9282, is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody


Immunohistochemical staining using MAT1A antibody (70R-1172)

MAT1A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MAT1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MAT1A antibody (70R-1172) | MAT1A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using MAT1A antibody (70R-1172) | Western Blot showing MAT1A antibody used at a concentration of 1.25 ug/ml against Jurkat Cell Lysate
  • Immunohistochemical staining using MAT1A antibody (70R-1172) | MAT1A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors