MAT2A antibody (70R-4054)

Rabbit polyclonal MAT2A antibody raised against the middle region of MAT2A

Synonyms Polyclonal MAT2A antibody, Anti-MAT2A antibody, MATA2 antibody, MAT2A, Methionine Adenosyltransferase Ii Alpha antibody, MATA 2, MATA 2 antibody, MATA-2 antibody, SAMS2 antibody, MATA-2, MATII antibody
Specificity MAT2A antibody was raised against the middle region of MAT2A
Cross Reactivity Human
Applications WB
Immunogen MAT2A antibody was raised using the middle region of MAT2A corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK
Assay Information MAT2A Blocking Peptide, catalog no. 33R-5128, is also available for use as a blocking control in assays to test for specificity of this MAT2A antibody

Images

Western Blot analysis using MAT2A antibody (70R-4054)

MAT2A antibody (70R-4054) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAT2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAT2A catalyzes the formation of S-adenosylmethionine from methionine and ATP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAT2A antibody (70R-4054) | MAT2A antibody (70R-4054) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors