Matrilin 1 antibody (70R-5353)

Rabbit polyclonal Matrilin 1 antibody raised against the middle region of MATN1

Synonyms Polyclonal Matrilin 1 antibody, Anti-Matrilin 1 antibody, Matrilin -1, CRTM antibody, Matrilin 1 Cartilage Matrix Protein antibody, MATN1 antibody, Matrilin 1, Matrilin -1 antibody, Matrilin 1 antibody, CMP antibody, Matrilin 1
Specificity Matrilin 1 antibody was raised against the middle region of MATN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Matrilin 1 antibody was raised using the middle region of MATN1 corresponding to a region with amino acids KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA
Assay Information Matrilin 1 Blocking Peptide, catalog no. 33R-4743, is also available for use as a blocking control in assays to test for specificity of this Matrilin 1 antibody


Western Blot analysis using Matrilin 1 antibody (70R-5353)

Matrilin 1 antibody (70R-5353) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MATN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Matrilin 1 antibody (70R-5353) | Matrilin 1 antibody (70R-5353) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors