Matrilin 3 antibody (70R-5335)

Rabbit polyclonal Matrilin 3 antibody raised against the middle region of MATN3

Synonyms Polyclonal Matrilin 3 antibody, Anti-Matrilin 3 antibody, MATN3 antibody, Matrilin -3 antibody, HOA antibody, Matrilin -3, Matrilin 3, Matrilin 3 antibody, Matrilin 3, EDM5 antibody
Specificity Matrilin 3 antibody was raised against the middle region of MATN3
Cross Reactivity Human,Mouse
Applications WB
Immunogen Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA
Assay Information Matrilin 3 Blocking Peptide, catalog no. 33R-3946, is also available for use as a blocking control in assays to test for specificity of this Matrilin 3 antibody


Western Blot analysis using Matrilin 3 antibody (70R-5335)

Matrilin 3 antibody (70R-5335) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MATN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Matrilin 3 antibody (70R-5335) | Matrilin 3 antibody (70R-5335) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors