MBL2 antibody (70R-4596)

Rabbit polyclonal MBL2 antibody raised against the middle region of MBL2

Synonyms Polyclonal MBL2 antibody, Anti-MBL2 antibody, MBL2, COLEC1 antibody, Mannose-Binding Lectin antibody, MBL antibody, MBL-2, MBP antibody, MBL 2 antibody, HSMBPC antibody, MGC116832 antibody, MBL 2, MBP1 antibody, Protein C 2 Soluble antibody, MBL-2 antibody, MGC116833 antibody
Specificity MBL2 antibody was raised against the middle region of MBL2
Cross Reactivity Human
Applications WB
Immunogen MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
Assay Information MBL2 Blocking Peptide, catalog no. 33R-4323, is also available for use as a blocking control in assays to test for specificity of this MBL2 antibody


Western Blot analysis using MBL2 antibody (70R-4596)

MBL2 antibody (70R-4596) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MBL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognises mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MBL2 antibody (70R-4596) | MBL2 antibody (70R-4596) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors