MBNL1 antibody (70R-4989)

Rabbit polyclonal MBNL1 antibody

Synonyms Polyclonal MBNL1 antibody, Anti-MBNL1 antibody, MBNL-1 antibody, Muscleblind-Like antibody, MBNL 1 antibody, MBNL1, MBNL-1, MBNL 1
Cross Reactivity Human, Dog
Applications IHC, WB
Immunogen MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI
Assay Information MBNL1 Blocking Peptide, catalog no. 33R-1389, is also available for use as a blocking control in assays to test for specificity of this MBNL1 antibody

Images

Immunohistochemical staining using MBNL1 antibody (70R-4989)

MBNL1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Liver. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MBNL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.75 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MBNL1 antibody (70R-4989) | MBNL1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using MBNL1 antibody (70R-4989) | MBNL1 antibody (70R-4989) used at 0.75 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors