MCM2 antibody (70R-5571)

Rabbit polyclonal MCM2 antibody raised against the middle region of MCM2

Synonyms Polyclonal MCM2 antibody, Anti-MCM2 antibody, MCM-2, D3S3194 antibody, MCM-2 antibody, BM28 antibody, cdc19 antibody, MCM 2, MCM2, MGC10606 antibody, CCNL1 antibody, MCM 2 antibody, CDCL1 antibody, Minichromosome Maintenance Complex Component 2 antibody, MITOTIN antibody, KIAA0030 antibody
Specificity MCM2 antibody was raised against the middle region of MCM2
Cross Reactivity Human
Applications WB
Immunogen MCM2 antibody was raised using the middle region of MCM2 corresponding to a region with amino acids NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL
Assay Information MCM2 Blocking Peptide, catalog no. 33R-6804, is also available for use as a blocking control in assays to test for specificity of this MCM2 antibody

Images

Western Blot analysis using MCM2 antibody (70R-5571)

MCM2 antibody (70R-5571) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 102 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MCM2 antibody (70R-5571) | MCM2 antibody (70R-5571) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors