MCM5 antibody (70R-1619)

Rabbit polyclonal MCM5 antibody raised against the N terminal of MCM5

Synonyms Polyclonal MCM5 antibody, Anti-MCM5 antibody, MCM 5 antibody, Minichromosome Maintenance Complex Component 5 antibody, MCM-5, MCM5, MCM-5 antibody, MCM 5
Specificity MCM5 antibody was raised against the N terminal of MCM5
Cross Reactivity Human
Applications WB
Immunogen MCM5 antibody was raised using the N terminal of MCM5 corresponding to a region with amino acids MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG
Assay Information MCM5 Blocking Peptide, catalog no. 33R-6425, is also available for use as a blocking control in assays to test for specificity of this MCM5 antibody

Images

Western Blot analysis using MCM5 antibody (70R-1619)

MCM5 antibody (70R-1619) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MCM5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by MCM5 is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MCM5 antibody (70R-1619) | MCM5 antibody (70R-1619) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors